Harga Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 Beserta Review

Di Fashion Pria

Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8

  • Harga:
  • Rp.140000
  • Tersedia di: BukaLapak
  • Buka Situs

 

SKU:
Kondisi produk:Baru
Nama toko penjual: hak7
Asal toko: Jakarta Barat (Bisa dikirim ke seluruh wilayah di Indonesia)

Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 adalah produk favorit pribadi saya . Barang unggulan ini telah direlease beberapa waktu yang lalu dan menjadi salah satu item yang populer di kategori Baju Tidur Pria. Produk ini sungguh populer karena harganya yang sangat murah namun memiliki kualitas yang spektakuler , sehingga Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 ini menjadi pilihan yang tepat untuk anda . Apabila Anda ingin membeli Produk Baju Tidur Pria, maka Produk Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 mungkin adalah cocok untuk Anda.

  • Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 merupakan produk unggulan di toko hak7.
  • Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 adalah produk yang istimewa. Dibuat dengan teknologi canggih dan dari bahan terbaik.
  • Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 ini menjadi salah satu produk terpopuler di online shop BukaLapak.com.
  • Item ini mempunyai ulasan yang sangat bagus di mata konsumen. Rata-rata dari mereka merasa puas setelah mempunyai Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8.
  • Permintaan untuk item Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8 ini sangat membludak hingga ketersediaan produk di beberapa penjual sangatlah terbatas

Mc137RendaPutihSetelanVibellebajutidurwanitaimporttanktopset.Rp69 NEWREADYBAJUTIDURPRIA/PIYAMADEWASACPLAKIMOTIFPYM8 .ALLSIZEFITTOXL#BajuLD115cm,panjangbaju72cm#Celanakaret PIYAMAPRIAPLAINNAVYBAJUTIDURCOWOKLAKIDEWASAFITXL Hargaproduksangatbaik JCCollectionCPPiyamaPriaSatinganPendek..Fashion:Pakaian:Piyamapriacelanabajutidurdewasakatundastershirtnavy hargaBajutidurpriapiyamadewasacplakimotifpym8Bukalapak.com..

Mc137RendaPutihSetelanVibellebajutidurwanitaimporttanktopset.Rp69 NEWREADYBAJUTIDURPRIA/PIYAMADEWASACPLAKIMOTIFPYM8 .Jul12,2018-DaftarHargaBajuTidurPriaDewasa-InformasihargaBajuTidurPriaDewasadari BajuTidurPriaDewasa,kamipersilahkanmelihatreviewkamiagarmendapatkan BajuTidurPriaPiyamaDewasaCPLakiMotifPYM8..Jul12,2018-HargaBajuTidurLakiLakiDewasa-InformasilisthargaBajuTidurLakiLakiDewasa khususnyaBajuTidurLakiLakiDewasa,kamipersilahkanmelihatreviewkami BajuTidurPriaPiyamaDewasaCPLakiMotifPYM8..

Produk ini dikirim dari Jakarta Barat dan bisa dikirim ke seluruh Indonesia meluputi kota: Jakarta, Surabaya, Medan, Bandung, Bekasi, Tangerang, Depok, Semarang, Palembang, Makassar, Tangerang Selatan, Bogor, Batam, Pekanbaru, Bandar Lampung, Malang, Padang, Denpasar, Samarinda, Tasikmalaya, Serang, Banjarmasin, Pontianak, Cimahi, Balikpapan, Jambi, Surakarta, Mataram, Manado, Yogyakarta, Cilegon, Kupang, Palu, Ambon, Tarakan, Sukabumi, Cirebon, Bengkulu, Pekalongan, Kediri, Tegal, Binjai, Pematangsiantar, Jayapura, Banda Aceh, Palangkaraya, Probolinggo, Banjarbaru, Pasuruan, Tanjungpinang, Gorontalo, Dumai, Madiun, Batu, Salatiga, Pangkalpinang, Lubuklinggau, Ternate, Bitung, Tanjungbalai, Tebingtinggi, Metro, Bontang, Padang Sidempuan, Blitar, Lhokseumawe, Singkawang, Parepare, Langsa, Banjar, Prabumulih, Mojokerto, Magelang, Sorong, Palopo, Bima, Bukittinggi, Bau-Bau, Ambarawa, Anyer, Bangil, Banjar (Jawa Barat), Banjarnegara, Bangkalan, Bantul, Banyumas, Banyuwangi, Batang, Blora, Bojonegoro, Bondowoso, Boyolali, Bumiayu, Brebes, Caruban, Cianjur, Ciamis, Cibinong, Cikampek, Cikarang, Cilacap, Demak, Garut, Gresik, Indramayu, Jember, Jepara, Jombang, Kajen, Karanganyar, Kebumen, Kendal, Kepanjen, Klaten, Kota Palabuhanratu, Kraksaan, Kudus, Kuningan, Lamongan, Lumajang, Magetan, Majalengka, Mojosari, Mungkid, Ngamprah, Nganjuk, Ngawi, Pacitan, Palabuhanratu, Pamekasan, Pandeglang, Pare, Pati, Pelabuhan Ratu, Pemalang, Ponorogo, Purbalingga, Purwakarta, Purwodadi, Purwokerto, Purworejo, Rangkasbitung, Rembang, Sampang, Sidayu, Sidoarjo, Singaparna, Situbondo, Slawi, Sleman, Soreang, Sragen, Subang, Sukoharjo, Sumber, Sumedang, Sumenep, Temanggung, Tigaraksa, Trenggalek, Tuban, Tulungagung, Ungaran, Wates, Wlingi, Wonogiri, Wonosari, Wonosobo, dan kota-kota lain seluruh Indonesia. Silahkan mengunjungi halaman produk di BukaLapak melalui link yang sudah kami berikan di atas untuk melihat informasi lengkap mengenai pengiriman produk ini.

  

Produk Terkait:

 

Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8

Baju Tidur Pria Piyama Dewasa CP Laki Motif PYM8

Rp.140000

 

Tersedia di: BukaLapak

Lihat Produk

 

Unik Baju Tidur Pria Dewasa Motif Kotak Kotak 04 Limited

Unik Baju Tidur Pria Dewasa Motif Kotak Kotak 04 Limited

Rp.148500

 

Tersedia di: BukaLapak

Lihat Produk

 

Promo Piyama baju tidur pria tangan panjang Berkualitas

Rp.182300

 

Tersedia di: BukaLapak

Lihat Produk

 

Unik Piyama baju tidur pria XL tangan panjang Murah

Rp.188900

 

Tersedia di: BukaLapak

Lihat Produk

 


Pencarian Terkait

loading...

Tags: #BukaLapak

Harga baju muslim pria kemeja koko 1f Paling Laris
Harga baju muslim pria kemeja koko 1f Paling Laris
    Produk Terkait:   baju muslim pria
Harga Jas Pria Terbaru dari Kulit Sintetis Super Premium Terpopuler
Harga Jas Pria Terbaru dari Kulit Sintetis Super Premium Terpopuler
    Produk Terkait:   Blazer pria premium
Harga sandal pria quicksurf 2182 Terpercaya
Harga sandal pria quicksurf 2182 Terpercaya
    Produk Terkait:   SANDALPRIA Rp.99500  
Baca Juga×

Top