Harga Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop PROMO

Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop - Bos Racun Nu Shop

  • Harga:
  • Rp.15000
  • Tersedia di: BukaLapak
  • Buka Situs


Kondisi produk:Baru
Nama toko penjual: Bos Racun Nu Shop
Asal toko: Semarang (Bisa dikirim ke seluruh wilayah di Indonesia)

Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop adalah salah satu produk terbaik . Barang unggulan ini telah dikenalkan ke publik baru-baru saja ini dan menjadi salah satu produk yang populer di kategori Pet Food. Produk ini sangatlah favorit karena harganya yang sangat terjangkau namun memiliki kualitas yang sangatlah baik , sehingga Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop ini memiliki banyak penggemar . Jika Anda berminat dengan Produk Pet Food, kami menyarankan Produk Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop bisa saja ialah sesuai pencarian Anda.

  • Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop merupakan produk unggulan di toko eliyadidik.
  • Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop adalah item yang istimewa. Dibuat dengan teknologi mutakhir dan dari bahan berkualitas tinggi.
  • Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop ini menjadi salah satu item favorit di online shop BukaLapak.com.
  • Item ini mempunyai review yang sangat bagus di mata konsumen. Rata-rata dari mereka sangat puas setelah memiliki Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop.
  • Permintaan untuk item Obat Tetes Mata Belekan dan Radang Hidung Kucing TRIXIN CAT Pet Stuff Petshop – Bos Racun Nu Shop ini sangatlah besar hingga ketersediaan produk di beberapa penjual sangatlah terbatas

JualObatsMataBelekanDanRadangHidungKucingTrixinCatPetStuffPetshopdenganHargaRp18.000dariTokoOnlineBosRacunNuShop,Semarang.BeliAnekaProdukVitaminHewanTerbarudieleveniaSekarang!.BeliObatsMataBelekandanRadangHidungKucingTRIXINCATPetStuffPetshop-BosRacunNuShopdenganhargamurahRp15.000diLapakBosRacunNuShopeliyadidik-Semarang.PengirimancepatPembayaran100 aman.BeliObatsMataBelekandanRadangHidungAnjingTRIXINDOGDROPSPetStuffPetshop-BosRacunNuShopdenganhargamurahRp16.500diLapakBosRacunNuShopeliyadidik-Semarang.PengirimancepatPembayaran100 aman.TRIXINCAT15ml,obatsmatadanhidungkucingFormulatedbyOtsudaanadalahobatsmatadanhidungyangefektifmengatasiperadangandaninfeksipadamatadanhidungpadakucingdanbinatangpeliharaanlainnya.KOMPOSISI:-GentamycinSulphate-DexamethasoneINDIKASI:-Meringankandanmenyembuhkaninflamasidaninfeksipadajaringan-jaringansekitarmata..

JualObatsMataBelekanDanRadangHidungKucingTrixinCatPetStuffPetshopdenganHargaRp18.000dariTokoOnlineBosRacunNuShop,Semarang.BeliAnekaProdukVitaminHewanTerbarudieleveniaSekarang!..sMataBelekanDanRadangHidungKucingTRIXINCAT.BeliObatsMataBelekandanRadangHidungKucingTRIXINCATPetStuffPetshop-BosRacunNuShopdenganhargamurahRp15.000diLapakBosRacunNuShopeliyadidik-Semarang.PengirimancepatPembayaran100 aman.TrixinCatadalahobatsmatadanhidungyangdiformulasikansecaraolehOtsudaankhususuntukkucingkesayangananda.Trixinsangatefektifuntukmengatasiperadangandaninfeksipadamatadanhidung.Obatsinimampumengobatimatamerah,mataberair,belekan,infeksidanhidungmeler..

Produk ini dikirim dari Semarang dan bisa dikirim ke seluruh Indonesia meluputi kota: Jakarta, Surabaya, Medan, Bandung, Bekasi, Tangerang, Depok, Semarang, Palembang, Makassar, Tangerang Selatan, Bogor, Batam, Pekanbaru, Bandar Lampung, Malang, Padang, Denpasar, Samarinda, Tasikmalaya, Serang, Banjarmasin, Pontianak, Cimahi, Balikpapan, Jambi, Surakarta, Mataram, Manado, Yogyakarta, Cilegon, Kupang, Palu, Ambon, Tarakan, Sukabumi, Cirebon, Bengkulu, Pekalongan, Kediri, Tegal, Binjai, Pematangsiantar, Jayapura, Banda Aceh, Palangkaraya, Probolinggo, Banjarbaru, Pasuruan, Tanjungpinang, Gorontalo, Dumai, Madiun, Batu, Salatiga, Pangkalpinang, Lubuklinggau, Ternate, Bitung, Tanjungbalai, Tebingtinggi, Metro, Bontang, Padang Sidempuan, Blitar, Lhokseumawe, Singkawang, Parepare, Langsa, Banjar, Prabumulih, Mojokerto, Magelang, Sorong, Palopo, Bima, Bukittinggi, Bau-Bau, Ambarawa, Anyer, Bangil, Banjar (Jawa Barat), Banjarnegara, Bangkalan, Bantul, Banyumas, Banyuwangi, Batang, Blora, Bojonegoro, Bondowoso, Boyolali, Bumiayu, Brebes, Caruban, Cianjur, Ciamis, Cibinong, Cikampek, Cikarang, Cilacap, Demak, Garut, Gresik, Indramayu, Jember, Jepara, Jombang, Kajen, Karanganyar, Kebumen, Kendal, Kepanjen, Klaten, Kota Palabuhanratu, Kraksaan, Kudus, Kuningan, Lamongan, Lumajang, Magetan, Majalengka, Mojosari, Mungkid, Ngamprah, Nganjuk, Ngawi, Pacitan, Palabuhanratu, Pamekasan, Pandeglang, Pare, Pati, Pelabuhan Ratu, Pemalang, Ponorogo, Purbalingga, Purwakarta, Purwodadi, Purwokerto, Purworejo, Rangkasbitung, Rembang, Sampang, Sidayu, Sidoarjo, Singaparna, Situbondo, Slawi, Sleman, Soreang, Sragen, Subang, Sukoharjo, Sumber, Sumedang, Sumenep, Temanggung, Tigaraksa, Trenggalek, Tuban, Tulungagung, Ungaran, Wates, Wlingi, Wonogiri, Wonosari, Wonosobo, dan kota-kota lain seluruh Indonesia. Silahkan mengunjungi halaman produk di BukaLapak melalui link yang sudah kami berikan di atas untuk melihat informasi lengkap mengenai pengiriman produk ini.


Produk Terkait:


HARNESS H + LEASH - kucing, musang,kelinci, puppy, small breed (Putih WH01)

HARNESS H + LEASH – kucing, musang,kelinci, puppy, small breed (Putih WH01)



Tersedia di: BukaLapak

Lihat Produk


Hygrometer Thermometer Indoor & Outdoor ( 2 sensor) - Ukur Suhu & Kelembaban

Hygrometer Thermometer Indoor & Outdoor ( 2 sensor) – Ukur Suhu & Kelembaban



Tersedia di: BukaLapak

Lihat Produk


Obat Infeksi Kulit dan Penyakit Kulit Kucing SCADIX CAT Pet Stuff Petshop – Bos Racun Nu Shop



Tersedia di: BukaLapak

Lihat Produk


Tepung Ikan Protein 55 – 58% (Kualitas terbaik) – 10 Kg



Tersedia di: BukaLapak

Lihat Produk


Pencarian Terkait


Tags: #BukaLapak

Harga Materai 6rb tahun 2003-2005 Terpercaya
Harga Materai 6rb tahun 2003-2005 Terpercaya
    Produk Terkait:   Jerman barat. 1946.
Baca Juga×
